PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0719
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 186aa    MW: 21671.6 Da    PI: 11.1741
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0719genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.44.7e-1177133561
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                  ++ rr+++NRe+ArrsR RK++ +e+L++ +  L  eN++L  +l  l  ++ ++++
  Gh_A12G0719  77 RKRRRMISNRESARRSRMRKQKHLENLRNQANRLRIENRQLTYRLRFLLYHCHRVRT 133
                  5789*************************************9998877777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-1173137IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-875129No hitNo description
PROSITE profilePS5021710.62275138IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.21E-1077127No hitNo description
PfamPF001702.4E-877132IPR004827Basic-leucine zipper domain
CDDcd147024.25E-1878129No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MLSTVPAIIS SNPMMESDPF PSLQSAWDCS QLFSTTQSVG PARSGSASTE LNQTQTQTHS  60
NSGLDESNQT LFIIDERKRR RMISNRESAR RSRMRKQKHL ENLRNQANRL RIENRQLTYR  120
LRFLLYHCHR VRTDNDRLRS ESTLLRQKLS DMHQNLLFKQ LQQFSSAWPC NNVTVMSEKI  180
PPPLII
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17680RKRRR
27697RKRRRMISNRESARRSRMRKQK
38996RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437168.11e-117PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2PR621e-117A0A0D2PR62_G
STRINGVIT_00s0541g00020.t019e-55(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.13e-32basic leucine-zipper 5